Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) amide (human)

PTH (1-31) amide (human) is a PTH analog.pTH (1-31) amide (human) stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release.

Product Specifications

Purity

≥95%

Molecular Weight

3940.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCMR/FAIM3 Protein, Human, Recombinant (hFc)
TMPY-04020-01 5 µg

FCMR/FAIM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
FCMR/FAIM3 Protein, Human, Recombinant (hFc)
TMPY-04020-02 10 µg

FCMR/FAIM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
FCMR/FAIM3 Protein, Human, Recombinant (hFc)
TMPY-04020-03 20 µg

FCMR/FAIM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
FCMR/FAIM3 Protein, Human, Recombinant (hFc)
TMPY-04020-04 50 µg

FCMR/FAIM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
FCMR/FAIM3 Protein, Human, Recombinant (hFc)
TMPY-04020-05 100 µg

FCMR/FAIM3 Protein, Human, Recombinant (hFc)

Sign In for Pricing
View Details
IQCE (NM_001100390) Human Over-expression Lysate
E45H05509-2 20 µg

IQCE (NM_001100390) Human Over-expression Lysate

Sign In for Pricing
View Details