Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) amide (human)

PTH (1-31) amide (human) is a PTH analog.pTH (1-31) amide (human) stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release.

Product Specifications

Purity

≥95%

Molecular Weight

3940.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT3 3'UTR GFP Stable Cell Line
TU055661 1.0 mL

DDIT3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SS18L1 (Biotin)
577842-01 50 µg

SS18L1 (Biotin)

Sign In for Pricing
View Details
SS18L1 (Biotin)
577842-02 100 µg

SS18L1 (Biotin)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O81 (strain ED1a) RIHA Polyclonal Antibody
MBS7176389 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) RIHA Polyclonal Antibody

Sign In for Pricing
View Details
FBXW4, CT (FBXW4, FBW4, SHFM3, F-box/WD repeat-containing protein 4, Dactylin, F-box and WD-40 domain-containing protein 4) (Azide free) (HRP) discontinued
035572-HRP 200 µL

FBXW4, CT (FBXW4, FBW4, SHFM3, F-box/WD repeat-containing protein 4, Dactylin, F-box and WD-40 domain-containing protein 4) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Tucatinib
S8362-5mg 5 mg

Tucatinib

Sign In for Pricing
View Details