Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) amide (human)

PTH (1-31) amide (human) is a PTH analog.pTH (1-31) amide (human) stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release.

Product Specifications

Purity

≥95%

Molecular Weight

3940.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps2 Mouse shRNA Plasmid (Locus ID 16898)
TL501254 1 Kit

Rps2 Mouse shRNA Plasmid (Locus ID 16898)

Sign In for Pricing
View Details
Human IL-9
MBS691501-01 0.002 mg

Human IL-9

Sign In for Pricing
View Details
Human IL-9
MBS691501-02 0.01 mg

Human IL-9

Sign In for Pricing
View Details
Human IL-9
MBS691501-03 5x 0.01 mg

Human IL-9

Sign In for Pricing
View Details
Spetex-2E AAV siRNA Pooled Vector
45279166 1.0 µg

Spetex-2E AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human Filamin A-interacting protein 1-like (FILIP1L), partial
MBS9020650-01 0.02 mg (E-Coli)

Recombinant Human Filamin A-interacting protein 1-like (FILIP1L), partial

Sign In for Pricing
View Details