Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) amide (human)

PTH (1-31) amide (human) is a PTH analog.pTH (1-31) amide (human) stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release.

Product Specifications

Purity

≥95%

Molecular Weight

3940.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAP91 (Synaptosomal-Associated Protein, 91kD, CALM, AP180) discontinued
219241-01 20 µL

SNAP91 (Synaptosomal-Associated Protein, 91kD, CALM, AP180) discontinued

Sign In for Pricing
View Details
SNAP91 (Synaptosomal-Associated Protein, 91kD, CALM, AP180) discontinued
219241-02 100 µL

SNAP91 (Synaptosomal-Associated Protein, 91kD, CALM, AP180) discontinued

Sign In for Pricing
View Details
Phospho-GEF H1 (Ser886) Peptide
AF4483-BP 1 mg

Phospho-GEF H1 (Ser886) Peptide

Sign In for Pricing
View Details
Kv21/KCNB1 Polyclonal Rabbit Polyclonal Antibody
E53P05151 100 µL

Kv21/KCNB1 Polyclonal Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD74 Antibody
E51A14155 100 µL

CD74 Antibody

Sign In for Pricing
View Details
Human MYOM1 activation kit by CRISPRa
GA105800 1 Kit

Human MYOM1 activation kit by CRISPRa

Sign In for Pricing
View Details