Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide K, porcine

The brain tachykinin NPK is also a major tachykinin in plasma and tumor tissues of carcinoid patients.

Product Specifications

Purity

≥95%

Molecular Weight

5980.6

Notes

For research use only.

AA Sequence

DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), CF594 conjugate, 0.1mg/mL
BNC940750-100 1x 100 µL

CD8 (C8/468 + C8/144B), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF740 conjugate, 0.1mg/mL
BNC741858-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/1094), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF568 conjugate, 0.1mg/mL
BNC682295-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details