Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide W-30 (human)

Neuropeptide W-30 is a peptide that has been shown to activate the receptor for neuropeptide W (NPW) . Neuropeptide W is a member of the tachykinin family of peptides, which are known to function as activators of G protein-coupled receptors. Neuropeptide W-30 has been shown to be a potent inhibitor of ion channels and ligand-gated ion channels, including potassium channels, calcium channels, and sodium channels. Neuropeptide W-30 also blocks the release of neurotransmitters such as acetylcholine, noradrenaline, dopamine, and serotonin in animal cells.

Product Specifications

Purity

≥95%

Molecular Weight

3543.17

Notes

For research use only.

AA Sequence

WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS707525 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
DMT
TRC-D469620-500MG 500 mg

DMT

Sign In for Pricing
View Details
YPEL3 antibody
FNab09569 100 µg

YPEL3 antibody

Sign In for Pricing
View Details
Tenocyclidine Hydrochloride
TRC-T018450-5MG 5 mg

Tenocyclidine Hydrochloride

Sign In for Pricing
View Details
Human Dermokine (DMKN) ELISA Kit
RDR-DMKN-Hu-01 96 Tests

Human Dermokine (DMKN) ELISA Kit

Sign In for Pricing
View Details
Human Dermokine (DMKN) ELISA Kit
RDR-DMKN-Hu-02 48 Tests

Human Dermokine (DMKN) ELISA Kit

Sign In for Pricing
View Details