Neuropeptide W-30 (human)
Neuropeptide W-30 is a peptide that has been shown to activate the receptor for neuropeptide W (NPW) . Neuropeptide W is a member of the tachykinin family of peptides, which are known to function as activators of G protein-coupled receptors. Neuropeptide W-30 has been shown to be a potent inhibitor of ion channels and ligand-gated ion channels, including potassium channels, calcium channels, and sodium channels. Neuropeptide W-30 also blocks the release of neurotransmitters such as acetylcholine, noradrenaline, dopamine, and serotonin in animal cells.
Product Specifications
Purity
≥95%
Molecular Weight
3543.17
Notes
For research use only.
AA Sequence
WYKHVASPRYHTVGRAAGLLMGLRRSPYLW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog