Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide W-30 (human)

Neuropeptide W-30 is a peptide that has been shown to activate the receptor for neuropeptide W (NPW) . Neuropeptide W is a member of the tachykinin family of peptides, which are known to function as activators of G protein-coupled receptors. Neuropeptide W-30 has been shown to be a potent inhibitor of ion channels and ligand-gated ion channels, including potassium channels, calcium channels, and sodium channels. Neuropeptide W-30 also blocks the release of neurotransmitters such as acetylcholine, noradrenaline, dopamine, and serotonin in animal cells.

Product Specifications

Purity

≥95%

Molecular Weight

3543.17

Notes

For research use only.

AA Sequence

WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc5a4b Protein Vector (Mouse) (pPB-C-His)
PV231162 500 ng

Slc5a4b Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
pCMV-SPORT6-SCARB2 Plasmid
PVT13069 2 µg

pCMV-SPORT6-SCARB2 Plasmid

Sign In for Pricing
View Details
RTL1 (NM_001134888) Human Tagged ORF Clone
RG226388 10 µg

RTL1 (NM_001134888) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum GATA zinc finger domain-containing protein 4 (gtaD), partial
MBS1476663 Inquire

Recombinant Dictyostelium discoideum GATA zinc finger domain-containing protein 4 (gtaD), partial

Sign In for Pricing
View Details
Anti-Zebrafish Ush2a-like Antibody, HRP Conjugate
DZ33954-HRP 200 µL/Vial

Anti-Zebrafish Ush2a-like Antibody, HRP Conjugate

Sign In for Pricing
View Details
Bovine Non secretory ribonuclease (RNASE2) ELISA Kit
GTR10353235 96 Well

Bovine Non secretory ribonuclease (RNASE2) ELISA Kit

Sign In for Pricing
View Details