Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (3-36), human

Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4) . Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor.

Product Specifications

Purity

≥95%

Solubility

DMSO: 100 mg/mL

Molecular Weight

4011.48

Notes

For research use only.

AA Sequence

SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSL1 Human qPCR Primer Pair (NM_015471)
HP226722 200 Reactions

NSL1 Human qPCR Primer Pair (NM_015471)

Sign In for Pricing
View Details
Aspartate Aminotransferase (GOT1) Human Knockdown Lysate
LY300347 100 µg

Aspartate Aminotransferase (GOT1) Human Knockdown Lysate

Sign In for Pricing
View Details
Spats2l Mouse Gene Knockout Kit (CRISPR)
KN516570 1 Kit

Spats2l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VASP Recombinant Rabbit Monoclonal Antibody [SY02-16]
ET1607-6 100 µL

VASP Recombinant Rabbit Monoclonal Antibody [SY02-16]

Sign In for Pricing
View Details
Dabigatran-d3
TRC-D100092-5MG 5 mg

Dabigatran-d3

Sign In for Pricing
View Details
Trimetazidine N-Carboxylic Acid Ethyl Ester
TRC-T795530-1G 1 g

Trimetazidine N-Carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details