Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (3-36), human

Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4) . Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor.

Product Specifications

Purity

≥95%

Solubility

DMSO: 100 mg/mL

Molecular Weight

4011.48

Notes

For research use only.

AA Sequence

SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin Recombinant Rabbit monoclonal Antibody
HA750094 100 µL

Calponin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
YY1 Human Gene Knockout Kit (CRISPR)
KN207198RB 1 Kit

YY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZYG11B activation kit by CRISPRa
GA112559 1 Kit

Human ZYG11B activation kit by CRISPRa

Sign In for Pricing
View Details
Hand-Held Chemical Identifier BDRD-301
BDRD-301 1 Unit

Hand-Held Chemical Identifier BDRD-301

Sign In for Pricing
View Details
Human PTPLAD1 (HACD3) activation kit by CRISPRa
GA109834 1 Kit

Human PTPLAD1 (HACD3) activation kit by CRISPRa

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3231), CF405S conjugate, 0.1mg/mL
BNC043231-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3231), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details