Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (3-36), human

Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4) . Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor.

Product Specifications

Purity

≥95%

Solubility

DMSO: 100 mg/mL

Molecular Weight

4011.48

Notes

For research use only.

AA Sequence

SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHD (NM_003002) Human Over-expression Lysate
LY418957 100 µg

SDHD (NM_003002) Human Over-expression Lysate

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF740 conjugate, 0.1mg/mL
BNC742290-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRR5-ARHGAP8 (NM_181334) Human Over-expression Lysate
LY432300 100 µg

PRR5-ARHGAP8 (NM_181334) Human Over-expression Lysate

Sign In for Pricing
View Details
Ube2q1 Mouse Gene Knockout Kit (CRISPR)
KN518586 1 Kit

Ube2q1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Peripherin (PRPH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E4]
TA806226AM 100 µL

Peripherin (PRPH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Pharynx
CS712726 5x 5 µm

Tissue FFPE Sections, Pharynx

Sign In for Pricing
View Details