Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-34) (porcine)

PTH (1-34) (porcine)

Product Specifications

Purity

≥95%

Molecular Weight

4117.72

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF680R conjugate, 0.1mg/mL
BNC811224-100 1x 100 µL

HCG-beta (HCGb/54+ HCGb/459), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF488A conjugate, 0.1mg/mL
BNC882029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF488A conjugate, 0.1mg/mL
BNC882368-500 1x 500 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details