Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-37) (human)

PTH (1-37) (human) is a fragment of parathyroid hormone (PTH) . pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

4401.08

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA5G CRISPRa sgRNA lentivector (set of three targets)(Human)
20898121 3x 1.0µg DNA

FRA5G CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
QTRT1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV773480 1.0 µg DNA

QTRT1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral mouse Wdr75 shRNA (UAS) - Lentiviral mouse Wdr75 shRNA (UAS, iRFP) (25)
GTR15255266 1 Vial

Lentiviral mouse Wdr75 shRNA (UAS) - Lentiviral mouse Wdr75 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal CCL28 Antibody (012) [HRP]
NBP2-89585H 0.1 mL

Rabbit Monoclonal CCL28 Antibody (012) [HRP]

Sign In for Pricing
View Details
N-Caffeoyl O-methyltyramine
C01263 5 mg

N-Caffeoyl O-methyltyramine

Sign In for Pricing
View Details
Recombinant Escherichia coli Trehalose-6-phosphate synthase (otsA)
orb3155972-01 20 µg

Recombinant Escherichia coli Trehalose-6-phosphate synthase (otsA)

Sign In for Pricing
View Details