Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-37) (human)

PTH (1-37) (human) is a fragment of parathyroid hormone (PTH) . pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

4401.08

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Apoptosis-Stimulating Of P53 Protein 1 (ASPP1) ELISA
KBH7937 1x 96 Well

GENLISA Human Apoptosis-Stimulating Of P53 Protein 1 (ASPP1) ELISA

Sign In for Pricing
View Details
MYH9 Rabbit mAb Antibody
orb1952028 100 µL

MYH9 Rabbit mAb Antibody

Sign In for Pricing
View Details
RAB25 (NM_020387) Human Recombinant Protein
E45H40360M5 20 µg

RAB25 (NM_020387) Human Recombinant Protein

Sign In for Pricing
View Details
MicroMolar Universal Kinase Assay Kit -1000
MUK1000K- 1000 assays

MicroMolar Universal Kinase Assay Kit -1000

Sign In for Pricing
View Details
[4- (4-Amino-6,7-dimethoxy-2-quinazolinyl) -1-piperazinyl][ (5S) -tetrahydro-5-methyl-2-furanyl]-methanone
IA63848-01 1 mg

[4- (4-Amino-6,7-dimethoxy-2-quinazolinyl) -1-piperazinyl][ (5S) -tetrahydro-5-methyl-2-furanyl]-methanone

Sign In for Pricing
View Details
[4- (4-Amino-6,7-dimethoxy-2-quinazolinyl) -1-piperazinyl][ (5S) -tetrahydro-5-methyl-2-furanyl]-methanone
IA63848-02 5 mg

[4- (4-Amino-6,7-dimethoxy-2-quinazolinyl) -1-piperazinyl][ (5S) -tetrahydro-5-methyl-2-furanyl]-methanone

Sign In for Pricing
View Details