Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-37) (human)

PTH (1-37) (human) is a fragment of parathyroid hormone (PTH) . pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

4401.08

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPA1 (NM_003090) Human Tagged ORF Clone
RG206856 10 µg

SNRPA1 (NM_003090) Human Tagged ORF Clone

Sign In for Pricing
View Details
EZH2 Antibody
SAB275-01 50 µL

EZH2 Antibody

Sign In for Pricing
View Details
EZH2 Antibody
SAB275-02 100 µL

EZH2 Antibody

Sign In for Pricing
View Details
Aromatase Recombinant Antibody, Biotin Conjugated
bsm-61426R-Biotin-TR 20 µL

Aromatase Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CLCA2 Antibody (1B9)
H00009635-M01 0.1 mg

Mouse Monoclonal CLCA2 Antibody (1B9)

Sign In for Pricing
View Details
HIC1 Polyclonal Antibody
31728-01 50 µL

HIC1 Polyclonal Antibody

Sign In for Pricing
View Details