PTH (1-37) (human)
PTH (1-37) (human) is a fragment of parathyroid hormone (PTH) . pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis.
Product Specifications
Purity
≥95%
Molecular Weight
4401.08
Notes
For research use only.
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
489486 100 µL
PRRG1 (Transmembrane Gamma-Carboxyglutamic Acid Protein 1, Proline Rich Gla (G-Carboxyglutamic Acid) 1)
Sign In for Pricing
View Details