Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (free acid) (human)

Neuropeptide Y free acid lacks the level of activity of the amidated peptide.

Product Specifications

Purity

≥95%

Molecular Weight

4272.8

Notes

For research use only.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-100 1x 100 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details