PTH (1-84) (dog)
PTH (1-84) (dog) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
Product Specifications
Purity
≥95%
Molecular Weight
9470.64
Notes
For research use only.
AA Sequence
SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
R1059r 1 Each
Rat Prg2 / Bone marrow proteoglycan Recombinant Protein
Sign In for Pricing
View Details 
GTR15350579 1 Vial
Lentiviral human CTAGE6 shRNA (UAS) - Lentiviral human CTAGE6 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 