PTH (1-84) (dog)
PTH (1-84) (dog) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
Product Specifications
Purity
≥95%
Molecular Weight
9470.64
Notes
For research use only.
AA Sequence
SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
AAP56912-100UG 100 µg
ANKRD39 Peptide - N-terminal region (AAP56912)
Sign In for Pricing
View Details P4256-34Q-Biotin 100 µL
PAI-1 (Plasminogen Activator Inhibitor Type 1, SERPINE1, PAI, PAI1, PAI-1, PLANH1, Serine (or Cysteine) Proteinase Inhibitor, Clade E (Nexin, Plasminogen Activator Inhibitor Type 1), Member 1, Plasminogen Activator Inhibitor, Type I) (Biotin)
Sign In for Pricing
View Details 
MBS9332521-01 48 Well
Human Tubulin-folding cofactor B, TBCB ELISA Kit
Sign In for Pricing
View Details 
MBS9332521-02 96 Well
Human Tubulin-folding cofactor B, TBCB ELISA Kit
Sign In for Pricing
View Details MBS9332521-03 5x 96 Well
Human Tubulin-folding cofactor B, TBCB ELISA Kit
Sign In for Pricing
View Details