PTH (1-84) (dog)
PTH (1-84) (dog) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
Product Specifications
Purity
≥95%
Molecular Weight
9470.64
Notes
For research use only.
AA Sequence
SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1431217 Inquire
Recombinant Acanthamoeba polyphaga mimivirus Putative ankyrin repeat protein L88 (MIMI_L88), partial
Sign In for Pricing
View Details 
LV786023 1.0 µg DNA
SLC35G4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 