Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-84) (dog)

PTH (1-84) (dog) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

9470.64

Notes

For research use only.

AA Sequence

SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Apelin 36, AP-36 ELISA KIT
E1331Ra-01 48 Well

Rat Apelin 36, AP-36 ELISA KIT

Sign In for Pricing
View Details
Rat Apelin 36, AP-36 ELISA KIT
E1331Ra-02 96 Well

Rat Apelin 36, AP-36 ELISA KIT

Sign In for Pricing
View Details
Rat Apelin 36, AP-36 ELISA KIT
E1331Ra-03 5x 96 Tests

Rat Apelin 36, AP-36 ELISA KIT

Sign In for Pricing
View Details
Rat Apelin 36, AP-36 ELISA KIT
E1331Ra-04 10x 96 Tests

Rat Apelin 36, AP-36 ELISA KIT

Sign In for Pricing
View Details
ACADL Antibody Blocking Peptide
orb1503940 500 µg

ACADL Antibody Blocking Peptide

Sign In for Pricing
View Details
Rat IFN-alpha/beta R2 Protein, His Tag
IFA-R52H1-100ug 100 µg

Rat IFN-alpha/beta R2 Protein, His Tag

Sign In for Pricing
View Details