Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL - 37, Antimicrobial Peptide, human

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.

Product Specifications

Purity

≥95%

Solubility

Water: 50mg/mL

Molecular Weight

4493.37

Notes

For research use only.

AA Sequence

[LL-37, 37 aa]

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI8A11]
CF805566 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI8A11]

Sign In for Pricing
View Details
Polystyrene A SH
HA16020004.0.25G 25 g

Polystyrene A SH

Sign In for Pricing
View Details
(±)-Littorine
TRC-A894630-250MG 250 mg

(±)-Littorine

Sign In for Pricing
View Details
Fos B (FOSB) Rabbit Polyclonal Antibody
TA376320 100 µL

Fos B (FOSB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF568 conjugate, 0.1mg/mL
BNC681295-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Captafol
TRC-C175743-25MG 25 mg

Captafol

Sign In for Pricing
View Details