Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL - 37, Antimicrobial Peptide, human

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.

Product Specifications

Purity

≥95%

Solubility

Water: 50mg/mL

Molecular Weight

4493.37

Notes

For research use only.

AA Sequence

[LL-37, 37 aa]

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4,6-Tris(pentadecafluoroheptyl)-1,3,5-triazine
TRC-T896145-1G 1 g

2,4,6-Tris(pentadecafluoroheptyl)-1,3,5-triazine

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF740 conjugate, 0.1mg/mL
BNC742029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Di(n-butyl-d9) 1,10-Decanedioate
TRC-D429527-5MG 5 mg

Di(n-butyl-d9) 1,10-Decanedioate

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS620017 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details
TIMP3 (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040408-500 1x 500 µL

TIMP3 (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tributyl Trimellitate
TRC-T886463-500MG 500 mg

Tributyl Trimellitate

Sign In for Pricing
View Details