Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL - 37, Antimicrobial Peptide, human

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.

Product Specifications

Purity

≥95%

Solubility

Water: 50mg/mL

Molecular Weight

4493.37

Notes

For research use only.

AA Sequence

[LL-37, 37 aa]

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(Benzyloxy)-2-hydroxy-5-(sulfooxy)benzoic Acid
TRC-B279285-500MG 500 mg

4-(Benzyloxy)-2-hydroxy-5-(sulfooxy)benzoic Acid

Sign In for Pricing
View Details
Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate
LC400883 20 µg

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF594 conjugate, 0.1mg/mL
BNC942046-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP15 Rabbit Polyclonal Antibody
AP06228PU-N 100 µg

MMP15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833T-01 25 µg

Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09833T-02 100 µg

Elab Fluor® Violet 610 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details