Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL - 37, reverse sequence

LL - 37, reverse sequence

Product Specifications

Purity

≥95%

Molecular Weight

4493.37

Notes

For research use only.

AA Sequence

SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IGF-I/IGF-1 Antibody (OTI4B12) [Alexa Fluor 532]

NBP2-71010AF532 0.1 mL

Mouse Monoclonal IGF-I/IGF-1 Antibody (OTI4B12) [Alexa Fluor 532]

Sign In for Pricing

Endoplasmin

AP83371 1 mg

Endoplasmin

Sign In for Pricing

Quinoline-2-boronic acid

65045731 100 mg

Quinoline-2-boronic acid

Sign In for Pricing

Rat Angiogenin (ANG) ELISA Kit

orb1949847-01 48 Tests

Rat Angiogenin (ANG) ELISA Kit

Sign In for Pricing

Rat Angiogenin (ANG) ELISA Kit

orb1949847-02 96 Tests

Rat Angiogenin (ANG) ELISA Kit

Sign In for Pricing

C1orf145 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

K0213606 1.0 µg DNA

C1orf145 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing