Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL - 37, reverse sequence

LL - 37, reverse sequence

Product Specifications

Purity

≥95%

Molecular Weight

4493.37

Notes

For research use only.

AA Sequence

SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBR2 Antibody
MBS7130679-01 0.1 mL

TGFBR2 Antibody

Sign In for Pricing
View Details
TGFBR2 Antibody
MBS7130679-02 5x 0.1 mL

TGFBR2 Antibody

Sign In for Pricing
View Details
HOXC4 Peptide
orb2020997 100 µg

HOXC4 Peptide

Sign In for Pricing
View Details
Rabbit Monoclonal AK3L1 Antibody (014) [Alexa Fluor 750]
NBP2-90094AF750 0.1 mL

Rabbit Monoclonal AK3L1 Antibody (014) [Alexa Fluor 750]

Sign In for Pricing
View Details
TEX37 Antibody
A44749-100UL 100 µL

TEX37 Antibody

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
RA25913-01 50 µL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details