Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Asp56) -pTH (1-84) (rat)

(Asp56) -pTH (1-84) (rat)

Product Specifications

Purity

≥95%

Molecular Weight

9358.7

Notes

For research use only.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEDNVLVDGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synuclein, alpha (SNCA, Alpha Synuclein, MGC110988, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, PARK1, PARK4, Parkinson Disease Familial 1, PD1)
S9500-32 1 mg

Synuclein, alpha (SNCA, Alpha Synuclein, MGC110988, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, PARK1, PARK4, Parkinson Disease Familial 1, PD1)

Sign In for Pricing
View Details
PHYHIP antibody
70R-1231 100 ug

PHYHIP antibody

Sign In for Pricing
View Details
Human EPM2AIP1 Matched Antibody Pair Set [ABP-Q-0595]
ABP-Q-0595 5 Plates

Human EPM2AIP1 Matched Antibody Pair Set [ABP-Q-0595]

Sign In for Pricing
View Details
Azosemide (Standard)
HY-107321R-01 5 mg

Azosemide (Standard)

Sign In for Pricing
View Details
Azosemide (Standard)
HY-107321R-02 10 mg

Azosemide (Standard)

Sign In for Pricing
View Details
Azosemide (Standard)
HY-107321R-03 25 mg

Azosemide (Standard)

Sign In for Pricing
View Details