Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Asp56) -pTH (1-84) (rat)

(Asp56) -pTH (1-84) (rat)

Product Specifications

Purity

≥95%

Molecular Weight

9358.7

Notes

For research use only.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEDNVLVDGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dengue Virus 3 E antigen Recombinant Protein liquid
IDGVDNGV3EANTR10UG 1 Each

Dengue Virus 3 E antigen Recombinant Protein liquid

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Heart, Aorta Valve (Paraffin)
MBS640123-01 5 Sections

Tissue, Section, Human Adult Normal, Heart, Aorta Valve (Paraffin)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Heart, Aorta Valve (Paraffin)
MBS640123-02 5x 5 Sections

Tissue, Section, Human Adult Normal, Heart, Aorta Valve (Paraffin)

Sign In for Pricing
View Details
(+) - Praeruptorin C
T23183 25 mg

(+) - Praeruptorin C

Sign In for Pricing
View Details
Influenza A H1N2 (A/Minnesota/14/2012) Hemagglutinin / HA Protein (His Tag)
PO55393M2 100 µg

Influenza A H1N2 (A/Minnesota/14/2012) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
PSMD11 Peptide
orb2020515 100 µg

PSMD11 Peptide

Sign In for Pricing
View Details