(Asp56) -pTH (1-84) (rat)
(Asp56) -pTH (1-84) (rat)
Product Specifications
Purity
≥95%
Molecular Weight
9358.7
Notes
For research use only.
AA Sequence
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEDNVLVDGN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
12-1139-20 20 µg
Anti-CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) Recombinant Mouse Monoclonal Antibody (Clone:rCFTR/1342)
Sign In for Pricing
View Details MBS627758-01 0.2 mL
CNOT4, NT (E3 Ubiquitin-protein Ligase CNOT4, CCR4-associated Factor 4, Potential Transcriptional Repressor NOT4Hp, CCR4-NOT Transcription Complex Subunit 4, NOT4)
Sign In for Pricing
View Details MBS627758-02 5x 0.2 mL
CNOT4, NT (E3 Ubiquitin-protein Ligase CNOT4, CCR4-associated Factor 4, Potential Transcriptional Repressor NOT4Hp, CCR4-NOT Transcription Complex Subunit 4, NOT4)
Sign In for Pricing
View Details 
MBS6227120-01 0.1 mL
CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1) (MaxLight 650)
Sign In for Pricing
View Details MBS6227120-02 5x 0.1 mL
CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1) (MaxLight 650)
Sign In for Pricing
View Details 