Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Asp56) -pTH (1-84) (rat)

(Asp56) -pTH (1-84) (rat)

Product Specifications

Purity

≥95%

Molecular Weight

9358.7

Notes

For research use only.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEDNVLVDGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFPI1 Rabbit Polyclonal Antibody (Biotin)
orb2129872 100 µL

SFPI1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
FA2H Overexpression Lysate (Native) - (Dry Ice)
NBL1-10415 0.1 mg

FA2H Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
PCT (Procalcitonin) BioAssayTM ELISA Kit (Rat) discontinued
357937-01 48 Tests

PCT (Procalcitonin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
PCT (Procalcitonin) BioAssayTM ELISA Kit (Rat) discontinued
357937-02 96 Tests

PCT (Procalcitonin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
SIA8C (ST8SIA3) Human Over-expression Lysate
orb1348668 100 µg

SIA8C (ST8SIA3) Human Over-expression Lysate

Sign In for Pricing
View Details
APOC4 Polyclonal Antibody
BT-AP14257-01 20 µL

APOC4 Polyclonal Antibody

Sign In for Pricing
View Details