Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (2-38) (human)

PTH (2-38) (human)

Product Specifications

Purity

≥95%

Molecular Weight

4371.06

Notes

For research use only.

AA Sequence

VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGR antibody
10R-2141 100 µL

PGR antibody

Sign In for Pricing
View Details
Stain Free SDS-PAGE Gel Casting Kit (6%)
G4840-01 40 Tests (0.75 mm)

Stain Free SDS-PAGE Gel Casting Kit (6%)

Sign In for Pricing
View Details
Stain Free SDS-PAGE Gel Casting Kit (6%)
G4840-02 100 Tests (0.75 mm)

Stain Free SDS-PAGE Gel Casting Kit (6%)

Sign In for Pricing
View Details
TBC1D7 Antibody, FITC conjugated
MBS7045337-01 0.05 mg

TBC1D7 Antibody, FITC conjugated

Sign In for Pricing
View Details
TBC1D7 Antibody, FITC conjugated
MBS7045337-02 0.1 mg

TBC1D7 Antibody, FITC conjugated

Sign In for Pricing
View Details
TBC1D7 Antibody, FITC conjugated
MBS7045337-03 5x 0.1 mg

TBC1D7 Antibody, FITC conjugated

Sign In for Pricing
View Details