Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (2-38) (human)

PTH (2-38) (human)

Product Specifications

Purity

≥95%

Molecular Weight

4371.06

Notes

For research use only.

AA Sequence

VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFIP2 (NM_012402) Human Tagged ORF Clone
RC201781 10 µg

ARFIP2 (NM_012402) Human Tagged ORF Clone

Sign In for Pricing
View Details
GPC3 ELISA Kit (Mouse) (OKEH05763)
OKEH05763 96 Well

GPC3 ELISA Kit (Mouse) (OKEH05763)

Sign In for Pricing
View Details
Human PTP4A3 ELISA Kit (Ready to Use)
orb552126-01 48 Tests

Human PTP4A3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human PTP4A3 ELISA Kit (Ready to Use)
orb552126-02 96 Tests

Human PTP4A3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
NDST3 Rabbit Polyclonal Antibody (Cy5.5)
orb1074284 100 µL

NDST3 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
PISD, ID (Phosphatidylserine Decarboxylase Proenzyme, Phosphatidylserine Decarboxylase alpha Chain, Phosphatidylserine Decarboxylase beta Chain) (PE)
MBS6493629-01 0.2 mL

PISD, ID (Phosphatidylserine Decarboxylase Proenzyme, Phosphatidylserine Decarboxylase alpha Chain, Phosphatidylserine Decarboxylase beta Chain) (PE)

Sign In for Pricing
View Details