Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (2-38) (human)

PTH (2-38) (human)

Product Specifications

Purity

≥95%

Molecular Weight

4371.06

Notes

For research use only.

AA Sequence

VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MEK3/MAP2K3 Antibody Picoband®
PA1377-1 100 µg/Vial

Anti-MEK3/MAP2K3 Antibody Picoband®

Sign In for Pricing
View Details
C14orf28 Rabbit Polyclonal Antibody (HRP)
orb2110268 100 µL

C14orf28 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
RTF1 discontinued
531655-01 20 µL

RTF1 discontinued

Sign In for Pricing
View Details
RTF1 discontinued
531655-02 100 µL

RTF1 discontinued

Sign In for Pricing
View Details
OR2A5 siRNA (Human)
CRJ8050-01 15 nmol

OR2A5 siRNA (Human)

Sign In for Pricing
View Details
OR2A5 siRNA (Human)
CRJ8050-02 30 nmol

OR2A5 siRNA (Human)

Sign In for Pricing
View Details