Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide W-30 (rat)

Neuropeptide W-30 (rat)

Product Specifications

Purity

≥95%

Molecular Weight

3559.17

Notes

For research use only.

AA Sequence

WYKHVASPRYHTVGRASGLLMGLRRSPYLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRTOMT activation kit by CRISPRa
GA116559 1 Kit

Human LRTOMT activation kit by CRISPRa

Sign In for Pricing
View Details
Human C19orf28 (MFSD12) activation kit by CRISPRa
GA114935 1 Kit

Human C19orf28 (MFSD12) activation kit by CRISPRa

Sign In for Pricing
View Details
GCLC Polyclonal Antibody
E-AB-52359-01 20 µL

GCLC Polyclonal Antibody

Sign In for Pricing
View Details
GCLC Polyclonal Antibody
E-AB-52359-02 60 µL

GCLC Polyclonal Antibody

Sign In for Pricing
View Details
GCLC Polyclonal Antibody
E-AB-52359-03 120 µL

GCLC Polyclonal Antibody

Sign In for Pricing
View Details
GCLC Polyclonal Antibody
E-AB-52359-04 200 µL

GCLC Polyclonal Antibody

Sign In for Pricing
View Details