Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide W-30 (rat)

Neuropeptide W-30 (rat)

Product Specifications

Purity

≥95%

Molecular Weight

3559.17

Notes

For research use only.

AA Sequence

WYKHVASPRYHTVGRASGLLMGLRRSPYLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

"5-Androsten-3,17-dione (>90%)"
TRC-A637563-50MG 50 mg

"5-Androsten-3,17-dione (>90%)"

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS806550 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
Disperse Orange 29 (Technical Grade)
TRC-D494493-500MG 500 mg

Disperse Orange 29 (Technical Grade)

Sign In for Pricing
View Details
PCBP3 (NM_020528) Human Recombinant Protein
TP329176L 1 mg

PCBP3 (NM_020528) Human Recombinant Protein

Sign In for Pricing
View Details
(4E, 8Z)-Sphingadienine-C18-1-phosphate
TRC-S680655-10MG 10 mg

(4E, 8Z)-Sphingadienine-C18-1-phosphate

Sign In for Pricing
View Details
Human LRRTM1 activation kit by CRISPRa
GA117658 1 Kit

Human LRRTM1 activation kit by CRISPRa

Sign In for Pricing
View Details