Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (7-84) (human)

PTH (7-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

8780.93

Notes

For research use only.

AA Sequence

LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus Influenzae rpsS Protein (aa 1-91) (strain PittEE)
VAng-Lsx03845-1mgEcoli 1 mg (E. coli)

Recombinant Haemophilus Influenzae rpsS Protein (aa 1-91) (strain PittEE)

Sign In for Pricing
View Details
Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC)
MBS6508047-01 0.1 mL

Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC)

Sign In for Pricing
View Details
Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC)
MBS6508047-02 5x 0.1 mL

Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC)

Sign In for Pricing
View Details
Spnb4 Protein Vector (Mouse) (pPM-C-His)
PV233513 500 ng

Spnb4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
[KO Validated] HNRNPR Rabbit pAb
E45R29423N-100 100 µL

[KO Validated] HNRNPR Rabbit pAb

Sign In for Pricing
View Details
Dopamine Transporter Recombinant Antibody, FITC Conjugated
bsm-61434R-FITC-TR 20 µL

Dopamine Transporter Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details