Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (7-84) (human)

PTH (7-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

8780.93

Notes

For research use only.

AA Sequence

LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Apolipoprotein L (APOL1) ELISA Kit
orb781657-01 48 Tests

Mouse Apolipoprotein L (APOL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein L (APOL1) ELISA Kit
orb781657-02 96 Tests

Mouse Apolipoprotein L (APOL1) ELISA Kit

Sign In for Pricing
View Details
Claudin 14 (CLDN14) (NM_144492) Human Over-expression Lysate
LH14007V 100 µg

Claudin 14 (CLDN14) (NM_144492) Human Over-expression Lysate

Sign In for Pricing
View Details
Olr1347 AAV Vector (Rat) (CMV)
33859106 1 µg

Olr1347 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Mouse Trypsinogen Activation Peptide, TAP ELISA Kit
E100769 1 Each

Mouse Trypsinogen Activation Peptide, TAP ELISA Kit

Sign In for Pricing
View Details
XPO5 Protein Vector (Human) (pPB-C-His)
PV046585 500 ng

XPO5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details