Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (7-84) (human)

PTH (7-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

8780.93

Notes

For research use only.

AA Sequence

LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paliperidone - Bio-X TM
BP164223 10 mg

Paliperidone - Bio-X TM

Sign In for Pricing
View Details
ATG13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2748807 1.0 µg DNA

ATG13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Thymidine Kinase Antibody
orb1731273 100 µL

Thymidine Kinase Antibody

Sign In for Pricing
View Details
SPINK7 Rabbit Polyclonal Antibody (AP)
orb914581 100 µL

SPINK7 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
SASS6, ID (SASS6, SAS6, Spindle assembly abnormal protein 6 homolog) (MaxLight 750) discontinued
041429-ML750 100 µL

SASS6, ID (SASS6, SAS6, Spindle assembly abnormal protein 6 homolog) (MaxLight 750) discontinued

Sign In for Pricing
View Details
A-Myb Peptide
AF9007-BP 1 mg

A-Myb Peptide

Sign In for Pricing
View Details