Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (7-84) (human)

PTH (7-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

8780.93

Notes

For research use only.

AA Sequence

LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR3E Rabbit Polyclonal Antibody (Cy3)
orb2805902 100 µg

HTR3E Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae moaC Protein (aa 1-161)
VAng-Lsx06995-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae moaC Protein (aa 1-161)

Sign In for Pricing
View Details
GPR4 sgRNA CRISPR Lentivector set (Human)
K0889001 3x 1.0 µg

GPR4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
GENLISA™ Keyhole Limpet Hemocyanin (KLH) ELISA
KLU0156 1x 96 Well

GENLISA™ Keyhole Limpet Hemocyanin (KLH) ELISA

Sign In for Pricing
View Details
ABT-199 (GDC-0199)
MBS575072 Inquire

ABT-199 (GDC-0199)

Sign In for Pricing
View Details
Mmu-miR-7238-5p miRNA Inhibitor
CIM1730-01 10 nmol

Mmu-miR-7238-5p miRNA Inhibitor

Sign In for Pricing
View Details