Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (7-84) (human)

PTH (7-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

8780.93

Notes

For research use only.

AA Sequence

LMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NF-L Antibody (NFL/736)
NBP2-44893-0.1mg 0.1 mg

Mouse Monoclonal NF-L Antibody (NFL/736)

Sign In for Pricing
View Details
Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)
MBS718336-01 0.02 mg (E-Coli)

Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)

Sign In for Pricing
View Details
Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)
MBS718336-02 0.02 mg (Yeast)

Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)

Sign In for Pricing
View Details
Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)
MBS718336-03 0.1 mg (E-Coli)

Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)

Sign In for Pricing
View Details
Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)
MBS718336-04 0.1 mg (Yeast)

Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)

Sign In for Pricing
View Details
Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)
MBS718336-05 0.02 mg (Baculovirus)

Recombinant Mouse DNA-directed RNA polymerases I and III subunit RPAC1 (Polr1c)

Sign In for Pricing
View Details