Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (18-48) (human)

PTH (18-48) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3505.02

Notes

For research use only.

AA Sequence

MERVEWLRKKLQDVHNFVALGAPLAPRDAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Robo4 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6303204 1.0 µg DNA

Robo4 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit D-Dimer (D2D) ELISA Kit
RD-D2D-Rb-48Tests 48 Tests

Rabbit D-Dimer (D2D) ELISA Kit

Sign In for Pricing
View Details
Bottle Wheaton 20Ml With Cap.
986541 500 / PCK

Bottle Wheaton 20Ml With Cap.

Sign In for Pricing
View Details
STAT6 Antibody
orb736859-01 1 mL

STAT6 Antibody

Sign In for Pricing
View Details
STAT6 Antibody
orb736859-02 3 mL

STAT6 Antibody

Sign In for Pricing
View Details
STAT6 Antibody
orb736859-03 6 mL

STAT6 Antibody

Sign In for Pricing
View Details