Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (18-48) (human)

PTH (18-48) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3505.02

Notes

For research use only.

AA Sequence

MERVEWLRKKLQDVHNFVALGAPLAPRDAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Aminopeptidase O (APO) ELISA Kit
201-15-0070 96 Tests

Canine Aminopeptidase O (APO) ELISA Kit

Sign In for Pricing
View Details
NMDMSB
HY-175093 1 Each

NMDMSB

Sign In for Pricing
View Details
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody
CAU22027-01 100 µL

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody

Sign In for Pricing
View Details
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody
CAU22027-02 200 µL

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody

Sign In for Pricing
View Details
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody
CAU22027-03 1 mL

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-TORC2 (Ser171) Polyclonal Antibody, PerCP Conjugated
bs-3415R-PerCP 100 µL

Phospho-TORC2 (Ser171) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details