Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (18-48) (human)

PTH (18-48) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3505.02

Notes

For research use only.

AA Sequence

MERVEWLRKKLQDVHNFVALGAPLAPRDAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilirubin (BSA)
abx165653-01 100 µg

Bilirubin (BSA)

Sign In for Pricing
View Details
Bilirubin (BSA)
abx165653-02 200 µg

Bilirubin (BSA)

Sign In for Pricing
View Details
Bilirubin (BSA)
abx165653-03 500 µg

Bilirubin (BSA)

Sign In for Pricing
View Details
Bilirubin (BSA)
abx165653-04 1 mg

Bilirubin (BSA)

Sign In for Pricing
View Details
Bilirubin (BSA)
abx165653-05 5 mg

Bilirubin (BSA)

Sign In for Pricing
View Details
Human IgG1 (K214R/L234A/L235A), kappa Isotype Control Antibody (HyHEL-10)
HV080163 100 µg

Human IgG1 (K214R/L234A/L235A), kappa Isotype Control Antibody (HyHEL-10)

Sign In for Pricing
View Details