Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (18-48) (human)

PTH (18-48) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3505.02

Notes

For research use only.

AA Sequence

MERVEWLRKKLQDVHNFVALGAPLAPRDAGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ca2+ channel P/Q-type alpha-1A polyclonal rabbit affinity purified
152 103 50 µg

Ca2+ channel P/Q-type alpha-1A polyclonal rabbit affinity purified

Sign In for Pricing
View Details
MRE11 Rabbit Polyclonal Antibody
AP06803PU-N 100 µg

MRE11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1- (2,5-Dimethylphenyl) -2,2,2-trifluoroethanone
PC1013436 1 Each

1- (2,5-Dimethylphenyl) -2,2,2-trifluoroethanone

Sign In for Pricing
View Details
N-Ethyl-N- (3-sulfopropyl) aniline sodium salt
274822-01 5 g

N-Ethyl-N- (3-sulfopropyl) aniline sodium salt

Sign In for Pricing
View Details
N-Ethyl-N- (3-sulfopropyl) aniline sodium salt
274822-02 10 g

N-Ethyl-N- (3-sulfopropyl) aniline sodium salt

Sign In for Pricing
View Details
N-Ethyl-N- (3-sulfopropyl) aniline sodium salt
274822-03 25 g

N-Ethyl-N- (3-sulfopropyl) aniline sodium salt

Sign In for Pricing
View Details