Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (1-29) (rat, mouse)

Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect.

Product Specifications

Purity

≥95%

Molecular Weight

3164.48

Notes

For research use only.

AA Sequence

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LACTB2 CytoSection
TS401465P5 25 Slides

LACTB2 CytoSection

Sign In for Pricing
View Details
CCNYL1 AAV Vector (Mouse) (CMV)
15417104 1 µg

CCNYL1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
CFHR1, Human (HEK293, His)
HY-P70055-01 5 µg

CFHR1, Human (HEK293, His)

Sign In for Pricing
View Details
CFHR1, Human (HEK293, His)
HY-P70055-02 10 µg

CFHR1, Human (HEK293, His)

Sign In for Pricing
View Details
CFHR1, Human (HEK293, His)
HY-P70055-03 50 µg

CFHR1, Human (HEK293, His)

Sign In for Pricing
View Details
CFHR1, Human (HEK293, His)
HY-P70055-04 100 µg

CFHR1, Human (HEK293, His)

Sign In for Pricing
View Details