Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (1-29) (rat, mouse)

Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect.

Product Specifications

Purity

≥95%

Molecular Weight

3164.48

Notes

For research use only.

AA Sequence

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5J2 Antibody - C-terminal region : FITC (ARP71138_P050-FITC)
ARP71138_P050-FITC 100 µL

OR5J2 Antibody - C-terminal region : FITC (ARP71138_P050-FITC)

Sign In for Pricing
View Details
Recombinant human Frizzled-10 protein
ATGP4151-100 100 µg

Recombinant human Frizzled-10 protein

Sign In for Pricing
View Details
EPG5 Human Pre-designed siRNA Set A
HY-RS04422 1 Set

EPG5 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Arylsulfatase K (ARSK) ELISA Kit
MBS2800229-01 48 Tests

Rat Arylsulfatase K (ARSK) ELISA Kit

Sign In for Pricing
View Details
Rat Arylsulfatase K (ARSK) ELISA Kit
MBS2800229-02 96 Tests

Rat Arylsulfatase K (ARSK) ELISA Kit

Sign In for Pricing
View Details
Rat Arylsulfatase K (ARSK) ELISA Kit
MBS2800229-03 5x 96 Tests

Rat Arylsulfatase K (ARSK) ELISA Kit

Sign In for Pricing
View Details