Galanin (swine)
Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively.
Product Specifications
Purity
≥95%
Solubility
DMSO: 100 mg/mL
Molecular Weight
3210.55
Notes
For research use only.
AA Sequence
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2404-06C1 50 µg
CD49b (CD49b Antigen, Alpha 2 Subunit of VLA2 Receptor, Alpha 2 Subunit of VLA-2 Receptor, Collagen Receptor, GPIa, Integrin alpha 2, ITGA2, Platelet Antigen Br, Platelet Glycoprotein GPIa, Platelet Glycoprotein Ia, Platelet Membrane Glycoprotein Ia, Very Late Activation Protein 2 Receptor alpha 2 Subunit, VLA2 alpha chain, VLA2, VLA-2 alpha chain, VLA-2, VLAA2)
Sign In for Pricing
View Details 
![CD71 (TFRC) Mouse Monoclonal Antibody [Clone 6H9]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
E45M16096V-2 50 µL
CD71 (TFRC) Mouse Monoclonal Antibody [Clone 6H9]
Sign In for Pricing
View Details