Galanin (swine)
Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively.
Product Specifications
Purity
≥95%
Solubility
DMSO: 100 mg/mL
Molecular Weight
3210.55
Notes
For research use only.
AA Sequence
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1448190-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 58 (WRKY58)
Sign In for Pricing
View Details MBS1448190-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 58 (WRKY58)
Sign In for Pricing
View Details MBS1448190-03 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 58 (WRKY58)
Sign In for Pricing
View Details MBS1448190-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 58 (WRKY58)
Sign In for Pricing
View Details MBS1448190-05 0.02 mg (Baculovirus)
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 58 (WRKY58)
Sign In for Pricing
View Details MBS1448190-06 0.02 mg (Mammalian-Cell)
Recombinant Arabidopsis thaliana Probable WRKY transcription factor 58 (WRKY58)
Sign In for Pricing
View Details