Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine)

Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively.

Product Specifications

Purity

≥95%

Solubility

DMSO: 100 mg/mL

Molecular Weight

3210.55

Notes

For research use only.

AA Sequence

GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methyl-1-phenyl-1H-imidazole-5-carboxylic acid hydrochloride
EEC95055-01 50 mg

2-Methyl-1-phenyl-1H-imidazole-5-carboxylic acid hydrochloride

Sign In for Pricing
View Details
2-Methyl-1-phenyl-1H-imidazole-5-carboxylic acid hydrochloride
EEC95055-02 0.5 g

2-Methyl-1-phenyl-1H-imidazole-5-carboxylic acid hydrochloride

Sign In for Pricing
View Details
4-Nitrophenyl trans-ferulate
MBS5318364-01 500 mg

4-Nitrophenyl trans-ferulate

Sign In for Pricing
View Details
4-Nitrophenyl trans-ferulate
MBS5318364-02 1 g

4-Nitrophenyl trans-ferulate

Sign In for Pricing
View Details
4-Nitrophenyl trans-ferulate
MBS5318364-03 5 g

4-Nitrophenyl trans-ferulate

Sign In for Pricing
View Details
4-Nitrophenyl trans-ferulate
MBS5318364-04 10 g

4-Nitrophenyl trans-ferulate

Sign In for Pricing
View Details