Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Ile5, Trp23, Tyr36) -pTH-Related Protein (1-36) (human, mouse, rat)

(Ile5, Trp23, Tyr36) -pTH-Related Protein (1-36) (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4324.9

Notes

For research use only.

AA Sequence

AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-100 1x 100 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF647 conjugate, 0.1mg/mL
BNC470764-100 1x 100 µL

CD79a (IGA/764), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF647 conjugate, 0.1mg/mL
BNC470907-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF594 conjugate, 0.1mg/mL
BNC941120-100 1x 100 µL

Ep-CAM / CD326 (EGP40/1120), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF640R conjugate, 0.1mg/mL
BNC402560-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details