Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPHA2, Human (HEK293, His)

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPHA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpha2-protein-human-hek293-his.html

Purity

95.0

Smiles

QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

Molecular Formula

170589 (Gene_ID) Q96T91 (Q24-Y129) (Accession)

Molecular Weight

Approximately 23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal MRG15 Antibody (OTI5D2) [Alexa Fluor 647]
NBP2-72778AF647 0.1 mL

Mouse Monoclonal MRG15 Antibody (OTI5D2) [Alexa Fluor 647]

Ask
View Details
Human Indole-3-Acetic Acid (IAA) ELISA Kit
MBS3804433-01 48 Well

Human Indole-3-Acetic Acid (IAA) ELISA Kit

Ask
View Details
Human Indole-3-Acetic Acid (IAA) ELISA Kit
MBS3804433-02 96 Well

Human Indole-3-Acetic Acid (IAA) ELISA Kit

Ask
View Details
Human Indole-3-Acetic Acid (IAA) ELISA Kit
MBS3804433-03 5x 96 Well

Human Indole-3-Acetic Acid (IAA) ELISA Kit

Ask
View Details
Human Indole-3-Acetic Acid (IAA) ELISA Kit
MBS3804433-04 10x 96 Well

Human Indole-3-Acetic Acid (IAA) ELISA Kit

Ask
View Details
Lentiviral human CHEK2 sgRNA gene knockout kit - Lentiviral human CHEK2 sgRNA gene knockout kit (100)
GTR15395197 1 Vial

Lentiviral human CHEK2 sgRNA gene knockout kit - Lentiviral human CHEK2 sgRNA gene knockout kit (100)

Ask
View Details