Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPHA2, Human (HEK293, His)

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPHA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpha2-protein-human-hek293-his.html

Purity

95.0

Smiles

QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

Molecular Formula

170589 (Gene_ID) Q96T91 (Q24-Y129) (Accession)

Molecular Weight

Approximately 23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LMX1A (LIM Homeobox Transcription Factor 1-alpha, LIM/Homeobox Protein 11, LMX-11, LIM/Homeobox Protein LMX1A, LMX1A) (MaxLight 550) discontinued
302536-ML550 100 µL

LMX1A (LIM Homeobox Transcription Factor 1-alpha, LIM/Homeobox Protein 11, LMX-11, LIM/Homeobox Protein LMX1A, LMX1A) (MaxLight 550) discontinued

Ask
View Details
FITC Rat Monoclonal Antibody [Clone ID: 4-4-20 (enhanced)]
TA385649 200 µg

FITC Rat Monoclonal Antibody [Clone ID: 4-4-20 (enhanced)]

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)
MBS1412446-01 0.02 mg (E-Coli)

Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)
MBS1412446-02 0.1 mg (E-Coli)

Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)
MBS1412446-03 0.02 mg (Yeast)

Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)
MBS1412446-04 0.1 mg (Yeast)

Recombinant Lactococcus lactis subsp. lactis Single-stranded DNA-binding protein 1 (ssb1)

Ask
View Details