Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPHA2, Human (HEK293, His)

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GPHA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpha2-protein-human-hek293-his.html

Purity

95.0

Smiles

QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

Molecular Formula

170589 (Gene_ID) Q96T91 (Q24-Y129) (Accession)

Molecular Weight

Approximately 23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXO1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]
TA810711AM 100 µL

FOXO1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]

Ask
View Details
Donkey Guanine Nucleotide-Binding Protein G (GNAO1) ELISA Kit
MBS9388542 Inquire

Donkey Guanine Nucleotide-Binding Protein G (GNAO1) ELISA Kit

Ask
View Details
FZR1 (NM_001136198) Human Tagged Lenti ORF Clone
RC226627L3 10 µg

FZR1 (NM_001136198) Human Tagged Lenti ORF Clone

Ask
View Details
FITC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2110034-01 0.1 mL

FITC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Ask
View Details
FITC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2110034-02 0.2 mL

FITC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Ask
View Details
FITC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)
MBS2110034-03 0.5 mL

FITC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acetyltransferase 1 (ACAT1)

Ask
View Details