GPHA2, Human (HEK293, His)
GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GPHA2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gpha2-protein-human-hek293-his.html
Purity
95.0
Smiles
QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
Molecular Formula
170589 (Gene_ID) Q96T91 (Q24-Y129) (Accession)
Molecular Weight
Approximately 23 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
ACSL3, NT (Long-chain-fatty-acid-CoA Ligase 3, Long-chain Acyl-CoA Synthetase 3, FACL3, ACS3, LACS3) (MaxLight 550)
ACSL3, NT (Long-chain-fatty-acid-CoA Ligase 3, Long-chain Acyl-CoA Synthetase 3, FACL3, ACS3, LACS3) (MaxLight 550)
